Micron Document




Sexual dimorphism
──────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────
top
Sexual dimorphism is the condition where sexes of the same species exhibit different morphological characteristics, including characteristics not directly involved in reproduction.cite-ref-1[1] The condition occurs in most dioecious species, which consist of most animals and some plants. Differences may include secondary sex characteristics, size, weight, color, markings, or behavioral or cognitive traits. Male-male reproductive competition has evolved a diverse array of sexually dimorphic traits. Aggressive utility traits such as "battle" teeth and blunt heads reinforced as battering rams are used as weapons in aggressive interactions between rivals. Passive displays such as ornamental feathering or song-calling have also evolved mainly through sexual selection.cite-ref-2[2] These differences may be subtle or exaggerated and may be subjected to sexual selection and natural selection. The opposite of dimorphism is monomorphism, when both biological sexes are phenotypically indistinguishable from each other.cite-ref-3[3]

Contents

Plants
Fish
Birds
Cells
Sources

──────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────

Overview

Ornamentation and coloration

Common and easily identified types of dimorphism consist of ornamentation and coloration, though not always apparent. A difference in the coloration of sexes within a given species is called sexual dichromatism, commonly seen in many species of birds and reptiles.cite-ref-4[4] Sexual selection leads to exaggerated dimorphic traits that are used predominantly in competition over mates.cite-ref-andersson-1994-5-0[5] The increased fitness resulting from ornamentation offsets its cost to produce or maintain, suggesting complex evolutionary implications, but the costs and evolutionary implications vary from species to species.cite-ref-6[6]

The peafowl constitute conspicuous illustrations of the principle. The ornate plumage of peacocks, as used in the courting display, attracts peahens. At first sight, one might mistake peacocks and peahens for completely different species because of the vibrant colours and the sheer size of the male's plumage; the peahen is of a subdued brown coloration.cite-ref-zi-2003-7-0[7] The plumage of the peacock increases its vulnerability to predators because it is a hindrance in flight, and it renders the bird conspicuous in general.cite-ref-zi-2003-7-1[7] Similar examples are manifold, such as in birds of paradisecite-ref-8[8] and argus pheasants.

Another example of sexual dichromatism is that of nestling blue tits. Males are chromatically more yellow than females. It is believed that this is obtained by the ingestion of green Lepidopteran larvae, which contain large amounts of the carotenoids lutein and zeaxanthin.cite-ref-9[9] This diet also affects the sexually dimorphic colours in the human-invisible ultraviolet spectrum.cite-ref-10[10] Hence, the male birds, although appearing yellow to humans, actually have a violet-tinted plumage that is seen by females. This plumage is thought to be an indicator of male parental abilities.cite-ref-11[11] Perhaps this is a good indicator for females because it shows that they are good at obtaining a food supply from which the carotenoid is obtained. There is a positive correlation between the chromas of the tail and breast feathers and body condition.cite-ref-johnsen-2003-12-0[12] Carotenoids play an important role in immune function for many animals, so carotenoid dependent signals might indicate health.cite-ref-13[13]

Frogs constitute another conspicuous illustration of the principle. There are two types of dichromatism for frog species: ontogenetic and dynamic. Ontogenetic frogs are more common and have permanent color changes in males or females. Ranoidea lesueuri is an example of a dynamic frog with temporary color changes in males during the breeding season.cite-ref-14[14] Hyperolius ocellatus is an ontogenetic frog with dramatic differences in both color and pattern between the sexes. At sexual maturity, the males display a bright green with white dorsolateral lines.cite-ref-15[15] In contrast, the females are rusty red to silver with small spots. The bright coloration in the male population attracts females and is an aposematic sign to potential predators.

Females often show a preference for exaggerated male secondary sexual characteristics in mate selection.cite-ref-16[16] The sexy son hypothesis explains that females prefer more elaborate males and select against males that are dull in color, independent of the species' vision.cite-ref-rubolini-2004-17-0[17]

Similar sexual dimorphism and mating choice are also observed in many fish species. For example, male guppies have colorful spots and ornamentations, while females are generally grey. Female guppies prefer brightly colored males to duller males.cite-ref-18[18]

In redlip blennies, only the male fish develops an organ at the anal-urogenital region that produces antimicrobial substances. During parental care, males rub their anal-urogenital regions over their nests' internal surfaces, thereby protecting their eggs from microbial infections, one of the most common causes for mortality in young fish.cite-ref-19[19]

Plants

Most flowering plants are hermaphroditic but approximately 6% of species have separate males and females (dioecy).cite-ref-renner-1995-20-0[20] Sexual dimorphism is common in dioecious plantscite-ref-21[21] and dioicous species.cite-ref-ramawat-2016-22-0[22]

Males and females in insect-pollinated species generally look similar to one another because plants provide rewards (e.g. nectar) that encourage pollinators to visit another similar flower, completing pollination. Catasetum orchids are one interesting exception to this rule. Male Catasetum orchids violently attach pollinia to euglossine bee pollinators. The bees will then avoid other male flowers but may visit the female, which looks different from the males.cite-ref-romero-1986-23-0[23]

Various other dioecious exceptions, such as Loxostylis alata, have visibly different sexes, with the effect of eliciting the most efficient behavior from pollinators, who then use the most efficient strategy in visiting each gender of flower instead of searching, say, for pollen in a nectar-bearing female flower.

Some plants, such as some species of Geranium, have what amounts to serial sexual dimorphism. The flowers of such species might, for example, present their anthers on opening, then shed the exhausted anthers after a day or two and perhaps change their colours as well while the pistil matures; specialist pollinators are very much inclined to concentrate on the exact appearance of the flowers they serve, which saves their time and effort and serves the interests of the plant accordingly. Some such plants go even further and change their appearance once fertilized, thereby discouraging further visits from pollinators. This is advantageous to both parties because it avoids damaging the developing fruit and wasting the pollinator's effort on unrewarding visits. In effect, the strategy ensures that pollinators can expect a reward every time they visit an appropriately advertising flower.

Females of the aquatic plant Vallisneria americana have floating flowers attached by a long flower stalk that are fertilized if they contact one of the thousands of free-floating flowers released by a male.cite-ref-eelgrass-24-0[24] Sexual dimorphism is most often associated with wind-pollination in plants due to selection for efficient pollen dispersal in males vs pollen capture in females, e.g. Leucadendron rubrum.cite-ref-friedman-2009-25-0[25]

Sexual dimorphism in plants can also be dependent on reproductive development. This can be seen in Cannabis sativa, a type of hemp, which have higher photosynthesis rates in males while growing but higher rates in females once the plants become sexually mature.cite-ref-geber-1999-26-0[26]

Every sexually reproducing extant species of the vascular plant has an alternation of generations; the plants we see about us generally are diploid sporophytes, but their offspring are not the seeds that people commonly recognize as the new generation. The seed actually is the offspring of the haploid generation of microgametophytes (pollen) and megagametophytes (the embryo sacs in the ovules). Each pollen grain accordingly may be seen as a male plant in its own right; it produces a sperm cell and is dramatically different from the female plant, the megagametophyte that produces the female gamete.

Insects

Insects display a wide variety of sexual dimorphism between taxa including size, ornamentation and coloration.cite-ref-27[27] The female-biased sexual size dimorphism observed in many taxa evolved despite intense male-male competition for mates.cite-ref-28[28] In the red mason bee (Osmia rufa), for example, the female is larger/broader than males, with males being 8–10 mm in size and females being 10–12 mm in size.cite-ref-29[29] In the hackberry emperor (Asterocampa celtis) females are similarly larger than males.cite-ref-30[30] The reason for the sexual dimorphism is due to provision size mass, in which females consume more pollen than males.cite-ref-31[31]

In some species, there is evidence of male dimorphism, but it appears to be for distinctions of roles. This is seen in the bee species Macrotera portalis in which there is a small-headed morph, capable of flight, and large-headed morph, incapable of flight, for males.cite-ref-danforth-1991-32-0[32] Anthidium manicatum also displays male-biased sexual dimorphism. The selection for larger size in males rather than females in this species may have resulted due to their aggressive territorial behavior and subsequent differential mating success.cite-ref-33[33] Another example is Lasioglossum hemichalceum, a species of sweat bee that shows drastic physical dimorphisms between male offspring.cite-ref-34[34] Not all dimorphism has to have a drastic difference between the sexes. Andrena agilissima is a mining bee where the females only have a slightly larger head than the males.cite-ref-35[35]

Weaponry leads to increased fitness by increasing success in male–male competition in many insect species.cite-ref-36[36] The beetle horns in Onthophagus taurus are enlarged growths of the head or thorax expressed only in the males. Copris ochus also has distinct sexual and male dimorphism in head horns.cite-ref-sugiura-2007-37-0[37] Another beetle with a distinct horn-related sexual dimorphism is Allomyrina dichotoma, also known as the Japanese rhinoceros beetle.cite-ref-38[38] These structures are impressive because of the exaggerated sizes.cite-ref-emlen-2005-39-0[39] There is a direct correlation between male horn lengths and body size and higher access to mates and fitness.cite-ref-emlen-2005-39-1[39] In other beetle species, both males and females may have ornamentation such as horns.cite-ref-sugiura-2007-37-1[37] Generally, insect sexual size dimorphism (SSD) within species increases with body size.cite-ref-40[40]

Some insects across various orders have larviform females, in which the female retains a larval shape into adulthood while males develop normally.cite-ref-41[41] A lesser version of this occurs in other insects with flightless females that have undeveloped wings.cite-ref-42[42]

Sexual dimorphism within insects is also displayed by dichromatism. In butterfly genera Bicyclus and Junonia, dimorphic wing patterns evolved due to sex-limited expression, which mediates the intralocus sexual conflict and leads to increased fitness in males.cite-ref-43[43] The sexual dichromatic nature of Bicyclus anynana is reflected by female selection on the basis of dorsal UV-reflective eyespot pupils.cite-ref-44[44] The common brimstone also displays sexual dichromatism; males have yellow and iridescent wings, while female wings are white and non-iridescent.cite-ref-45[45] Naturally selected deviation in protective female coloration is displayed in mimetic butterflies.cite-ref-46[46]

In ants, bees and stinging wasps (Aculeata), females of many species have a stinger modified from the ovipositor (egg-laying organ), while males never have a stinger.cite-ref-0-47-0[47] Additionally, most female aculeates have 12 antennal segments while males have 13.cite-ref-0-47-1[47] In eusocial aculeates (ants, social bees and social wasps), there is complicated dimorphism also involving castes. For example, in honeybees, the males (drones) are largest, with large heads and holoptic eyes (almost meeting at the top of the head).cite-ref-1-48-0[48] Reproductive females (queens) have longer bodies, with the abdomen being especially elongated during the egg-laying period, and the eyes are not holoptic.cite-ref-1-48-1[48] Females that generally do not reproduce (workers) are smaller than either drones or queens, and they have specialised structures (e.g. pollen baskets for carrying pollen) for the various kinds of work they perform.cite-ref-1-48-2[48]

Spiders and sexual cannibalism

Many arachnid groups exhibit sexual dimorphism,cite-ref-mclean-2018-49-0[49] but it is most widely studied in the spiders. In the orb-weaving spider Zygiella x-notata, for example, adult females have a larger body size than adult males.cite-ref-50[50] Size dimorphism shows a correlation with sexual cannibalism,cite-ref-prenter-1999-51-0[51] which is prominent in spiders (it is also found in insects such as praying mantises). In the size dimorphic wolf spider Tigrosa helluo, food-limited females cannibalize more frequently.cite-ref-wilder-2008-52-0[52] Therefore, there is a high risk of low fitness for males due to pre-copulatory cannibalism, which led to male selection of larger females for two reasons: higher fecundity and lower rates of cannibalism.cite-ref-wilder-2008-52-1[52] In addition, female fecundity is positively correlated with female body size and large female body size is selected for, which is seen in the family Araneidae. All Argiope species, including Argiope bruennichi, use this method. Some males evolved ornamentation including binding the female with silk, having proportionally longer legs, modifying the female's web, mating while the female is feeding, or providing a nuptial gift in response to sexual cannibalism.cite-ref-wilder-2008-52-2[52] Male body size is not under selection due to cannibalism in all spider species such as Nephila pilipes, but is more prominently selected for in less dimorphic species of spiders, which often selects for larger male size.cite-ref-53[53] In peacock spiders such as Maratus volans, the males are known for their characteristic colorful fan which attracts the females during mating.cite-ref-54[54]

Fish

Ray-finned fish are an ancient and diverse class, with the widest degree of sexual dimorphism of any animal class. Fairbairn notes that "females are generally larger than males but males are often larger in species with male–male combat or male paternal care ... [sizes range] from dwarf males to males more than 12 times heavier than females."cite-ref-55[55]

There are cases where males are substantially larger than females. An example is Lamprologus callipterus, a type of cichlid fish. In this fish, the males are characterized as being up to 60 times larger than the females. The male's increased size is believed to be advantageous because males collect and defend empty snail shells in each of which a female breeds.cite-ref-56[56] Males must be larger and more powerful in order to collect the largest shells. The female's body size must remain small because in order for her to breed, she must lay her eggs inside the empty shells. If she grows too large, she will not fit in the shells and will be unable to breed. The female's small body size is also likely beneficial to her chances of finding an unoccupied shell. Larger shells, although preferred by females, are often limited in availability.cite-ref-57[57] Hence, the female is limited to the growth of the size of the shell and may actually change her growth rate according to shell size availability.cite-ref-58[58] In other words, the male's ability to collect large shells depends on his size. The larger the male, the larger the shells he is able to collect. This then allows for females to be larger in his brooding nest which makes the difference between the sizes of the sexes less substantial. Male–male competition in this fish species also selects for large size in males. There is aggressive competition by males over territory and access to larger shells. Large males win fights and steal shells from competitors. Another example is the dragonet, in which males are considerably larger than females and possess longer fins.

Sexual dimorphism also occurs in hermaphroditic fish. These species are known as sequential hermaphrodites. In fish, reproductive histories often include the sex-change from female to male where there is a strong connection between growth, the sex of an individual, and the mating system within which it operates.cite-ref-59[59] In protogynous mating systems where males dominate mating with many females, size plays a significant role in male reproductive success.cite-ref-60[60] Males have a propensity to be larger than females of a comparable age but it is unclear whether the size increase is due to a growth spurt at the time of the sexual transition or due to the history of faster growth in sex changing individuals.cite-ref-61[61] Larger males are able to stifle the growth of females and control environmental resources.

Social organization plays a large role in the changing of sex by the fish. It is often seen that a fish will change its sex when there is a lack of a dominant male within the social hierarchy. The females that change sex are often those who attain and preserve an initial size advantage early in life. In either case, females which change sex to males are larger and often prove to be a good example of dimorphism.

In other cases with fish, males will go through noticeable changes in body size, and females will go through morphological changes that can only be seen inside of the body. For example, in sockeye salmon, males develop larger body size at maturity, including an increase in body depth, hump height, and snout length. Females experience minor changes in snout length, but the most noticeable difference is the huge increase in gonad size, which accounts for about 25% of body mass.cite-ref-hendry-1999-62-0[62]

Sexual selection was observed for female ornamentation in Gobiusculus flavescens, known as two-spotted gobies.cite-ref-amundsen-2001-63-0[63] Traditional hypotheses suggest that male–male competition drives selection. However, selection for ornamentation within this species suggests that showy female traits can be selected through either female–female competition or male mate choice.cite-ref-amundsen-2001-63-1[63] Since carotenoid-based ornamentation suggests mate quality, female two-spotted guppies that develop colorful orange bellies during breeding season are considered favorable to males.cite-ref-svensson-2006-64-0[64] The males invest heavily in offspring during incubation, which leads to the sexual preference in colorful females due to higher egg quality.cite-ref-svensson-2006-64-1[64]

Amphibians and non-avian reptiles

In amphibians and reptiles, the degree of sexual dimorphism varies widely among taxonomic groups. The sexual dimorphism in amphibians and reptiles may be reflected in any of the following: anatomy; relative length of tail; relative size of head; overall size as in many species of vipers and lizards; coloration as in many amphibians, snakes, and lizards, as well as in some turtles; an ornament as in many newts and lizards; the presence of specific sex-related behaviour is common to many lizards; and vocal qualities which are frequently observed in frogs.

Anole lizards show prominent size dimorphism with males typically being significantly larger than females. For instance, the average male Anolis sagrei was 53.4 mm vs. 40 mm in females.cite-ref-65[65] Different sizes of the heads in anoles have been explained by differences in the estrogen pathway.cite-ref-66[66] The sexual dimorphism in lizards is generally attributed to the effects of sexual selection, but other mechanisms including ecological divergence and fecundity selection provide alternative explanations.cite-ref-pinto-2005-67-0[67] The development of color dimorphism in lizards is induced by hormonal changes at the onset of sexual maturity, as seen in Psamodromus algirus, Sceloporus gadoviae, and S. undulates erythrocheilus.cite-ref-pinto-2005-67-1[67] Sexual dimorphism in size is also seen in frog species like P. bibronii.

Male painted dragon lizards, Ctenophorus pictus. are brightly conspicuous in their breeding coloration, but male colour declines with aging. Male coloration appears to reflect innate anti-oxidation capacity that protects against oxidative DNA damage.cite-ref-olsson-2012-68-0[68] Male breeding coloration is likely an indicator to females of the underlying level of oxidative DNA damage (a significant component of aging) in potential mates.cite-ref-olsson-2012-68-1[68]

Birds

Possible mechanisms have been proposed to explain macroevolution of sexual size dimorphism in birds. These include sexual selection, selection for fecundity in females, niche divergence between the sexes, and allometry, but their relative importance is still not fully understood .cite-ref-caron-2024-69-0[69]cite-ref-bravo-2024-70-0[70] Sexual dimorphism in birds can be manifested in size or plumage differences between the sexes. Sexual size dimorphism varies among taxa, with males typically being larger, though this is not always the case, e.g. birds of prey, hummingbirds, and some species of flightless birds.cite-ref-71[71]cite-ref-72[72] Plumage dimorphism, in the form of ornamentation or coloration, also varies, though males are typically the more ornamented or brightly colored sex.cite-ref-73[73] Such differences have been attributed to the unequal reproductive contributions of the sexes.cite-ref-74[74] This difference produces a stronger female choice since they have more risk in producing offspring. In some species, the male's contribution to reproduction ends at copulation, while in other species the male becomes the main (or only) caregiver. Plumage polymorphisms have evolved to reflect these differences and other measures of reproductive fitness, such as body conditioncite-ref-lindsay-2009-75-0[75] or survival.cite-ref-76[76] The male phenotype sends signals to females who then choose the 'fittest' available male.

Sexual dimorphism is a product of both genetics and environmental factors. An example of sexual polymorphism determined by environmental conditions exists in the red-backed fairywren. Red-backed fairywren males can be classified into three categories during breeding season: black breeders, brown breeders, and brown auxiliaries.cite-ref-lindsay-2009-75-1[75] These differences arise in response to the bird's body condition: if they are healthy they will produce more androgens thus becoming black breeders, while less healthy birds produce less androgens and become brown auxiliaries.cite-ref-lindsay-2009-75-2[75] The reproductive success of the male is thus determined by his success during each year's non-breeding season, causing reproductive success to vary with each year's environmental conditions.

Migratory patterns and behaviors also influence sexual dimorphisms. This aspect also stems back to size dimorphism in species. It has been shown that the larger males are better at coping with the difficulties of migration and thus are more successful in reproducing when reaching the breeding destination.cite-ref-77[77] When viewing this from an evolutionary standpoint, many theories and explanations come into consideration. If these are the result for every migration and breeding season, the expected results should be a shift towards a larger male population through sexual selection. Sexual selection is strong when the factor of environmental selection is also introduced. Environmental selection may support a smaller chick size if those chicks were born in an area that allowed them to grow to a larger size, even though under normal conditions they would not be able to reach this optimal size for migration. When the environment gives advantages and disadvantages of this sort, the strength of selection is weakened and the environmental forces are given greater morphological weight. The sexual dimorphism could also produce a change in timing of migration leading to differences in mating success within the bird population.cite-ref-78[78] When the dimorphism produces that large of a variation between the sexes and between the members of the sexes, multiple evolutionary effects can take place. This timing could even lead to a speciation phenomenon if the variation becomes strongly drastic and favorable towards two different outcomes. Sexual dimorphism is maintained by the counteracting pressures of natural selection and sexual selection. For example, sexual dimorphism in coloration increases the vulnerability of bird species to predation by European sparrowhawks in Denmark.cite-ref-m-ller-2006-79-0[79] Presumably, increased sexual dimorphism means males are brighter and more conspicuous, leading to increased predation.cite-ref-m-ller-2006-79-1[79] Moreover, the production of more exaggerated ornaments in males may come at the cost of suppressed immune function.cite-ref-lindsay-2009-75-3[75] So long as the reproductive benefits of the trait due to sexual selection are greater than the costs imposed by natural selection, then the trait will propagate throughout the population. Reproductive benefits arise in the form of a larger number of offspring, while natural selection imposes costs in the form of reduced survival. This means that even if the trait causes males to die earlier, the trait is still beneficial so long as males with the trait produce more offspring than males lacking the trait. This balance keeps dimorphism alive in these species and ensures that the next generation of successful males will also display these traits that are attractive to females.

Such differences in form and reproductive roles often cause differences in behavior. As previously stated, males and females often have different roles in reproduction. The courtship and mating behavior of males and females are regulated largely by hormones throughout a bird's lifetime.cite-ref-adkins-regan-2007-80-0[80] Activational hormones occur during puberty and adulthood and serve to 'activate' certain behaviors when appropriate, such as territoriality during breeding season.cite-ref-adkins-regan-2007-80-1[80] Organizational hormones occur only during a critical period early in development, either just before or just after hatching in most birds, and determine patterns of behavior for the rest of the bird's life.cite-ref-adkins-regan-2007-80-2[80] Such behavioral differences can cause disproportionate sensitivities to anthropogenic pressures.cite-ref-martin-2008-81-0[81] Females of the whinchat in Switzerland breed in intensely managed grasslands.cite-ref-martin-2008-81-1[81] Earlier harvesting of the grasses during the breeding season lead to more female deaths.cite-ref-martin-2008-81-2[81] Populations of many birds are often male-skewed and when sexual differences in behavior increase this ratio, populations decline at a more rapid rate.cite-ref-martin-2008-81-3[81] Also not all male dimorphic traits are due to hormones like testosterone, instead they are a naturally occurring part of development, for example plumage.cite-ref-82[82] In addition, the strong hormonal influence on phenotypic differences suggests that the genetic mechanism and genetic basis of these sexually dimorphic traits may involve transcription factors or cofactors rather than regulatory sequences.cite-ref-coyne-2008-83-0[83]

Sexual dimorphism may also influence differences in parental investment during times of food scarcity. For example, in the blue-footed booby, the female chicks grow faster than the males, resulting in booby parents producing the smaller sex, the males, during times of food shortage. This then results in the maximization of parental lifetime reproductive success.cite-ref-84[84] In bBlack-tailed godwits (Limosa limosa limosa) females are also the larger sex, and the growth rates of female chicks are more susceptible to limited environmental conditions.cite-ref-85[85]

Sexual dimorphism may also only appear during mating season; some species of birds only show dimorphic traits in seasonal variation. The males of these species will molt into a less bright or less exaggerated color during the off-breeding season.cite-ref-coyne-2008-83-1[83] This occurs because the species is more focused on survival than on reproduction, causing a shift into a less ornate state.

Consequently, sexual dimorphism has important ramifications for conservation. However, sexual dimorphism is not only found in birds and is thus important to the conservation of many animals. Such differences in form and behavior can lead to sexual segregation, defined as sex differences in space and resource use.cite-ref-main-2008-86-0[86] Most sexual segregation research has been done on ungulates,cite-ref-main-2008-86-1[86] but such research extends to bats,cite-ref-safi-2007-87-0[87] kangaroos,cite-ref-88[88] and birds.cite-ref-89[89] Sex-specific conservation plans have even been suggested for species with pronounced sexual segregation.cite-ref-safi-2007-87-1[87]

The term sesquimorphism (the Latin numeral prefix sesqui- means one-and-one-half, so halfway between mono- (one) and di- (two)) has been proposed for bird species in which "both sexes have basically the same plumage pattern, though the female is clearly distinguishable by reason of her paler or washed-out colour".cite-ref-summers-smith-1988-90-0[90] Examples include Cape sparrow (Passer melanurus),cite-ref-summers-smith-1988-90-1[90] rufous sparrow (subspecies P. motinensis motinensis),cite-ref-summers-smith-1988-90-2[90] and saxaul sparrow (P. ammodendri).cite-ref-summers-smith-1988-90-3[90]

Non-avian dinosaurs

Examining fossils of non-avian dinosaurs in search of sexually dimorphic characteristics requires the supply of complete and articulated skeletal and tissue remains. As terrestrial organisms, dinosaur carcasses are subject to ecological and geographical influence that inevitably constitutes the degree of preservation. The availability of well-preserved remains is not a probable outcome as a consequence of decomposition and fossilization. Some paleontologists have looked for sexual dimorphism among dinosaurs using statistics and comparison to ecologically or phylogenetically related modern animals.

Apatosaurus and Diplodocus

Female Apatosaurus and Diplodocus had interconnected caudal vertebrae that allowed them to keep their tails elevated to aid in copulation. Discovering that this fusion occurred in only 50% of Apatosaurus and Diplodocus skeletons and 25% of Camarasaurus skeletons indicated that this is a sexually dimorphic trait.

Theropoda

It has been hypothesized that male theropods possessed a retractable penis, a feature similar to modern day crocodilians. Crocodilian skeletons were examined to determine whether there is a skeletal component that is distinctive between both sexes, to help provide an insight on the physical disparities between male and female theropods. Findings revealed the caudal chevrons of male crocodiles, used to anchor the penis muscles, were significantly larger than those of females. There have been criticisms of these findings, but it remains a subject of debate among advocates and adversaries.

Ornithopoda

Studies of sexual dimorphism in hadrosaurs have generally centered on the distinctive cranial crests, which likely provided a function in sexual display. A biometric study of 36 skulls found sexual dimorphism was exhibited in the crest of 3 species of hadrosaurids. The crests could be categorized as full (male) or narrow (female) and may have given some advantage in intrasexual mating-competition.

Ceratopsians

According to Scott D. Sampson, if ceratopsids were to exhibit sexual dimorphism, modern ecological analogues suggest it would be found in display structures, such as horns and frills. No convincing evidence for sexual dimorphism in body size or mating signals is known in ceratopsids, although there is evidence that the more primitive ceratopsian Protoceratops andrewsi possessed sexes that were distinguishable based on frill and nasal prominence size. This is consistent with other known tetrapod groups where midsized animals tend to exhibit markedly more sexual dimorphism than larger ones. However, it has been proposed that these differences can be better explained by intraspecific and ontogenic variation rather than sexual dimorphism.cite-ref-maiorino-2015-91-0[91] In addition, many sexually dimorphic traits that may have existed in ceratopsians include soft tissue variations such as coloration or dewlaps, which would be unlikely to have been preserved in the fossil record.

Stegosaurians

A 2015 study on specimens of Hesperosaurus mjosi found evidence of sexual dimorphism in the shape of the dermal plates. Two plate morphs were described: one was short, wide, and oval-shaped, the other taller and narrower.cite-ref-92[92]cite-ref-93[93]

Mammals

In 45% of mammal species, males are larger than females, in 39%, males and females are the same size and in 16% of mammals, females are larger than males.cite-ref-94[94] Both genes and hormones affect the formation of many animal brains before "birth" (or hatching), and also behaviour of adult individuals. Hormones significantly affect human brain formation, and also brain development at puberty. A 2004 review in Nature Reviews Neuroscience observed that "because it is easier to manipulate hormone levels than the expression of sex chromosome genes, the effects of hormones have been studied much more extensively, and are much better understood, than the direct actions in the brain of sex chromosome genes." It concluded that while "the differentiating effects of gonadal secretions seem to be dominant," the existing body of research "support the idea that sex differences in neural expression of X and Y genes significantly contribute to sex differences in brain functions and disease."cite-ref-95[95]

Pinnipeds

Marine mammals show some of the greatest sexual size differences of mammals, because of sexual selection and environmental factors like breeding location.cite-ref-96[96] The mating system of pinnipeds varies from polygamy to serial monogamy. Pinnipeds are known for early differential growth and maternal investment since the only nutrients for newborn pups is the milk provided by the mother.cite-ref-97[97] For example, the males are significantly larger (about 10% heavier and 2% longer) than the females at birth in sea lion pups.cite-ref-98[98] The pattern of differential investment can be varied principally prenatally and post-natally.cite-ref-99[99] Mirounga leonina, the southern elephant seal, is one of the most dimorphic mammals.cite-ref-100[100]

Primates

Most anthropoid primates are sexually dimorphic for different biological characteristics, such as body size, canine tooth size, craniofacial structure, skeletal dimensions, pelage color and markings, and vocalization. But strepsirrhine primates and tarsiers are mostly monomorphic.

Humans

| | |
|---|---|
| | |
| Top: Stylised illustration of humans on the Pioneer plaque , showing both male (left) and female (right). Bottom: Comparison between male (left) and female (right) pelvises . | Top: Stylised illustration of humans on the Pioneer plaque , showing both male (left) and female (right). Bottom: Comparison between male (left) and female (right) pelvises . |

According to Clark Spencer Larsen, modern day Homo sapiens show a range of sexual dimorphism, with average body mass between the sexes differing by roughly 15%.cite-ref-101[101] Substantial discussion in academic literature considers potential evolutionary advantages associated with sexual competition (both intrasexual and intersexual), as well as short- and long-term sexual strategies.cite-ref-102[102] According to Daly and Wilson, "The sexes differ more in human beings than in monogamous mammals, but much less than in extremely polygamous mammals."cite-ref-103[103]

Pubertal changes in males lead to a ten times increase in testosterone compared to females. It is because of the effects of testosterone that males develop stronger and denser bones, as well as increased muscle mass and strength during puberty. On average, adult males have 10-20 times more testosterone than adult females, with male testosterone levels ranging from 300 to 1,000 nanograms per deciliter (ng/dL), while adult females have testosterone levels between 15 and 70 ng/dL.cite-ref-104[104]cite-ref-105[105] One study analysing children 5-10 years old, show that even before puberty, boys are still about 17% stronger in upper body and 8% stronger in the lower body than girls.cite-ref-2-106-0[106] It is after puberty that this gap widens significantly, with a study analysing adolescents aged 14-17 years old, shows males of the same age having 50% more upper body strength and 30% more lower body strength than females.cite-ref-2-106-1[106] Studies show that men have a higher Bone Mineral Density (BMD) than women. It shows BMD values of approximately 3.88 g/cm² for men and 2.90 g/cm² for women, showing that male bones are about 30% denser than female bones.cite-ref-107[107]cite-ref-108[108]

The average basal metabolic rate is about 6 percent higher in adolescent males than females and increases to about 10 percent higher after puberty. Females tend to convert more food into fat, while males convert more into muscle and expendable circulating energy reserves. According to Tim Hewett, director of research in the department of sports medicine at Ohio State University Wexner Medical Center, men have 40% greater upper body strength and 20% greater lower body strength.cite-ref-109[109]

The difference in strength relative to body mass is less pronounced in trained individuals. In Olympic weightlifting, male records vary from 5.5× body mass in the lowest weight category to 4.2× in the highest weight category, while female records vary from 4.4× to 3.8×, a weight-adjusted difference of only 10–20%, and an absolute difference of about 30% (i.e., 492 kg vs 348 kg for unlimited weight classes; see Olympic weightlifting records).

A study, carried out by analyzing annual world rankings from 1980 to 1996, found that males' running times were, on average, 10% faster than females', due to wider hips in females being a biomechanical disadvantage for running.cite-ref-110[110] This is because wider hips lead to a larger Q-angle (the angle between the hip and knee), which alters the alignment of the lower limbs in females. This would affect the efficiency of force transmission through the legs during running, and also less efficient running biomechanics compared to males with narrower hips and longer femurs.cite-ref-111[111]cite-ref-112[112] However, females have higher fatigue resistance than males, being able to resist fatigue better than males at submaximal efforts.cite-ref-113[113]cite-ref-114[114]

In early adolescence, females are on average taller than males (as females tend to go through puberty earlier), but males, on average, surpass them in height in later adolescence and adulthood. In the United States, adult males are on average 9% tallercite-ref-115[115] and 16.5% heaviercite-ref-116[116] than adult females.

Males typically have larger tracheae and branching bronchi, with about 30 percent greater lung volume per body mass. On average, males have larger hearts, slower heart rates, 10 percent higher red blood cell count, higher hemoglobin, hence greater oxygen-carrying capacity. They also have higher circulating clotting factors (vitamin K, prothrombin and platelets). These differences lead to faster healing of wounds and lower sensitivity to nerve pain after injury.cite-ref-glucksman-1981-117-0[117] In males, pain-causing injury to the peripheral nerve occurs through the microglia, while in females it occurs through the T cells (except in pregnant women, who follow a male pattern).cite-ref-dance-2019-118-0[118]

Females typically have more white blood cells (stored and circulating), as well as more granulocytes and B and T lymphocytes. Additionally, they produce more antibodies at a faster rate than males, hence they develop fewer infectious diseases and succumb for shorter periods.cite-ref-glucksman-1981-117-1[117] Ethologists argue that females, interacting with other females and multiple offspring in social groups, have experienced such traits as a selective advantage.cite-ref-119[119]cite-ref-120[120]cite-ref-121[121]cite-ref-122[122]cite-ref-123[123] Females have a higher sensitivity to pain due to aforementioned nerve differences that increase the sensation, and females thus require higher levels of pain medication after injury.cite-ref-dance-2019-118-1[118] Hormonal changes in females affect pain sensitivity, and pregnant women have the same sensitivity as males. Acute pain tolerance is also more consistent over a lifetime in females than males, despite these hormonal changes.cite-ref-124[124] Despite differences in physical feeling, both sexes have similar psychological tolerance to (or ability to cope with and ignore) pain.cite-ref-125[125]

In the human brain, a difference between sexes was observed in the transcription of the PCDH11X/Y gene pair unique to Homo sapiens.cite-ref-126[126] Sexual differentiation in the human brain from the undifferentiated state is triggered by testosterone from the fetal testis. Testosterone is converted to estrogen in the brain through the action of the enzyme aromatase. Testosterone acts on many brain areas, including the SDN-POA, to create the masculinized brain pattern.cite-ref-127[127] The brains of pregnant females carrying male fetuses may be shielded from the masculinizing effects of androgen through the action of sex hormone-binding globulin.cite-ref-128[128]

The relationship between sex differences in the brain and human behavior is a subject of controversy in psychology and society at large.cite-ref-fine-2010-129-0[129]cite-ref-jordan-young-2010-130-0[130] Many females tend to have a higher ratio of gray matter in the left hemisphere of the brain in comparison to males.cite-ref-marner-2003-131-0[131]cite-ref-gur-1999-132-0[132] Males on average have larger brains than females; however, when adjusted for total brain volume, the gray matter differences between sexes are almost nonexistent. Thus, the percentage of gray matter appears to be more related to brain size than it is to sex.cite-ref-133[133]cite-ref-134[134] Differences in brain physiology between sexes do not necessarily relate to differences in intellect. Haier et al. found in a 2004 study that "men and women apparently achieve similar IQ results with different brain regions, suggesting that there is no singular underlying neuroanatomical structure to general intelligence and that different types of brain designs may manifest equivalent intellectual performance".cite-ref-haier-2005-135-0[135] (See the sex and intelligence article for more on this subject.) Strict graph-theoretical analysis of the human brain connections revealedcite-ref-szalkai-2015-136-0[136] that in numerous graph-theoretical parameters (e.g., minimum bipartition width, edge number, the expander graph property, minimum vertex cover), the structural connectome of women are significantly "better" connected than the connectome of men. It was showncite-ref-szalkai-2018-137-0[137] that the graph-theoretical differences are due to the sex and not to the differences in the cerebral volume, by analyzing the data of 36 females and 36 males, where the brain volume of each man in the group was smaller than the brain volume of each woman in the group.

Sexual dimorphism was also described in the gene level and shown to extend from the sex chromosomes. Overall, about 6,500 genes have been found to have sex-differential expression in at least one tissue. Many of these genes are not directly associated with reproduction, but rather linked to more general biological features. In addition, it has been shown that genes with sex-specific expression undergo reduced selection efficiency, which leads to higher population frequencies of deleterious mutations and contributes to the prevalence of several human diseases.cite-ref-138[138]cite-ref-139[139]

Immune function

Sexual dimorphism in immune function is a common pattern in vertebrates and also in a number of invertebrates. Most often, females are more 'immunocompetent' than males. This trait is not consistent among all animals, but differs depending on taxonomy, with the most female-biased immune systems being found in insects.cite-ref-140[140] In mammals this results in more frequent and severe infections in males and higher rates of autoimmune disorders in females. One potential cause may be differences in gene expression of immune cells between the sexes.cite-ref-141[141] Another explanation is that endocrinological differences between the sexes impact the immune system – for example, testosterone acts as an immunosuppressive agent.cite-ref-142[142]

Cells

Phenotypic differences between sexes are evident even in cultured cells from tissues.cite-ref-pollitzer-2013-143-0[143] For example, female muscle-derived stem cells have a better muscle regeneration efficiency than male ones.cite-ref-deasy-2007-144-0[144] There are reports of several metabolic differences between male and female cellscite-ref-mittelstrass-2011-145-0[145] and they also respond to stress differently.cite-ref-penaloza-2009-146-0[146] These differences align with concepts of cell autonomous sex identity, where cells maintain intrinsic sex-based traits regardless of systemic influences.

Reproductively advantageous

In theory, larger females are favored by competition for mates, especially in polygamous species. Larger females offer an advantage in fertility, since the physiological demands of reproduction are limiting in females. Hence there is a theoretical expectation that females tend to be larger in species that are monogamous. Females are larger in many species of insects, many spiders, many fish, many reptiles, owls, birds of prey and certain mammals such as the spotted hyena, and baleen whales such as blue whale. As an example, in some species, females are sedentary, and so males must search for them. Fritz Vollrath and Geoff Parker argue that this difference in behaviour leads to radically different selection pressures on the two sexes, evidently favouring smaller males.cite-ref-vollrath-1992-147-0[147] Cases where the male is larger than the female have been studied as well,cite-ref-vollrath-1992-147-1[147] and require alternative explanations.

One example of this type of sexual size dimorphism is the black myotis bat (Myotis nigricans), where females are substantially larger than males in terms of body weight, skull measurement, and forearm length.cite-ref-148[148] The interaction between the sexes and the energy needed to produce viable offspring makes it favorable for females to be larger in this species. Females bear the energetic cost of producing eggs, which is much greater than the cost of making sperm by the males. The fecundity advantage hypothesis states that a larger female is able to produce more offspring and give them more favorable conditions to ensure their survival; this is true for most ectotherms. A larger female can provide parental care for a longer time while the offspring matures. The gestation and lactation periods are fairly long in M. nigricans, the females suckling their offspring until they reach nearly adult size.cite-ref-149[149] They would not be able to fly and catch prey if they did not compensate for the additional mass of the offspring during this time. Smaller male size may be an adaptation to increase maneuverability and agility, allowing males to compete better with females for food and other resources.

Some species of anglerfish also display extreme sexual dimorphism. Females are more typical in appearance to other fish, whereas males are tiny rudimentary creatures with stunted digestive systems. A male must find a female and fuse with her: he then lives parasitically, becoming little more than a sperm-producing body in what amounts to an effectively hermaphrodite composite organism. A similar situation is found in the Zeus water bug Phoreticovelia disparata where the female has a glandular area on her back that can serve to feed a male, which clings to her (although males can survive away from females, they generally are not free-living).cite-ref-150[150] This is taken to the logical extreme in the Rhizocephala crustaceans, like Sacculina barnacles, where the male injects itself into the female's body and becomes nothing more than sperm producing cells, to the point that the superorder used to be mistaken for hermaphroditic.cite-ref-151[151]

Some plant species also exhibit dimorphism in which the females are significantly larger than the males, such as in the moss Dicranumcite-ref-152[152] and the liverwort Sphaerocarpos.cite-ref-schuster-1984-153-0[153] There is some evidence that, in these genera, the dimorphism may be tied to a sex chromosome,cite-ref-schuster-1984-153-1[153]cite-ref-crum-1980-154-0[154] or to chemical signalling from females.cite-ref-155[155]

Evolution

In 1871, Charles Darwin advanced the theory of sexual selection, which related sexual dimorphism to sexual selection.cite-ref-157[157]

The first step towards sexual dimorphism is the size differentiation of sperm and eggs (anisogamy).cite-ref-158[158]cite-ref-159[159]cite-ref-160[160]cite-ref-161[161] Anisogamy and the usually large number of small male gametes relative to the larger female gametes usually lies in the development of strong sperm competition,cite-ref-162[162]cite-ref-163[163] because small sperm enable organisms to produce a large number of sperm, and make males (or male function of hermaphroditescite-ref-164[164]) more redundant.

Volvocine algae have been useful in understanding the evolution of sexual dimorphismcite-ref-165[165] and species like the cowpea seed beetle Callosobruchus maculatus, where the females are larger than the males, are used to study its underlying genetic mechanisms.cite-ref-166[166]

In many non-monogamous species, the benefit to a male's reproductive fitness of mating with multiple females is large, whereas the benefit to a female's reproductive fitness of mating with multiple males is small or nonexistent.cite-ref-futuyma-2005-167-0[167] In these species, there is a selection pressure for whatever traits enable a male to have more matings. The male may therefore come to have different traits from the female.

These traits could be ones that allow him to fight off other males for control of territory or a harem, such as large size or weapons;cite-ref-futuyma-2005-2-168-0[168] or they could be traits that females, for whatever reason, prefer in mates.cite-ref-futuyma-2005-3-169-0[169] Male–male competition poses no deep theoretical questionscite-ref-ridley-2004-170-0[170] but mate choice does.

Females may choose males that appear strong and healthy, thus likely to possess "good alleles" and give rise to healthy offspring.cite-ref-futuyma-2005-4-171-0[171] In some species, however, females seem to choose males with traits that do not improve offspring survival rates, and even traits that reduce it (potentially leading to traits like the peacock's tail).cite-ref-ridley-2004-170-1[170] Two hypotheses for explaining this fact are the sexy son hypothesis and the handicap principle.

The sexy son hypothesis states that females may initially choose a trait because it improves the survival of their young, but once this preference has become widespread, females must continue to choose the trait, even if it becomes harmful. Those that do not will have sons that are unattractive to most females (since the preference is widespread) and so receive few matings.cite-ref-ridley-2004-2-172-0[172]

The handicap principle states that a male who survives despite possessing some sort of handicap thus proves that the rest of his genes are "good alleles". If males with "bad alleles" could not survive the handicap, females may evolve to choose males with this sort of handicap; the trait is acting as a hard-to-fake signal of fitness.cite-ref-ridley-2004-3-173-0[173]

See also
References

cite-note-11. Encyclopedia of Animal Behaviour. Vol. 2. Academic Press. 21 January 2019. p. 7. ISBN 978-0-12-813252-4.
cite-note-22. citerefrallsmesnick2009Ralls K, Mesnick S (2009). "Sexual dimorphism". Encyclopedia of Marine Mammals. Academic Press. pp. 1005–1011. doi:10.1016/B978-0-12-373553-9.00233-9. ISBN 9780123735539.
cite-note-33. "Dictionary of Human Evolution and Biology". Human-biology.key-spot.ru. Archived from the original on 7 November 2017. Retrieved 3 November 2017.
cite-note-44. citerefarmentadunnwhittingham2008Armenta JK, Dunn PO, Whittingham LA (August 2008). "Quantifying avian sexual dichromatism: a comparison of methods". The Journal of Experimental Biology. 211 (Pt 15): 2423–30. Bibcode:2008JExpB.211.2423A. doi:10.1242/jeb.013094. PMID 18626076.
cite-note-andersson-1994-55. Andersson 1994, p. 8
cite-note-66. citerefzahavi1975Zahavi A (September 1975). "Mate selection-a selection for a handicap" (PDF). Journal of Theoretical Biology. 53 (1): 205–14. Bibcode:1975JThBi..53..205Z. CiteSeerX 10.1.1.586.3819. doi:10.1016/0022-5193(75)90111-3. PMID 1195756. Archived from the original (PDF) on 10 August 2017. Retrieved 14 May 2011.
cite-note-zi-2003-77. citerefziyulihu2003Zi J, Yu X, Li Y, Hu X, Xu C, Wang X, et al. (October 2003). "Coloration strategies in peacock feathers". Proceedings of the National Academy of Sciences of the United States of America. 100 (22): 12576–8. Bibcode:2003PNAS..10012576Z. doi:10.1073/pnas.2133313100. PMC 240659. PMID 14557541.
cite-note-88. "Birds-of-Paradise: Beauty Kings". National Geographic Society. 19 October 2023. Retrieved 22 November 2023.
cite-note-99. citerefslagsvoldlifjeld1985Slagsvold T, Lifjeld JT (1985). "Variation in plumage colour of the Great tit Parus major in relation to habitat, season and food". Journal of Zoology. 206 (3): 321–328. doi:10.1111/j.1469-7998.1985.tb05661.x.
cite-note-1010. citerefbowmakerheathwilkiehunt1997Bowmaker, J.K.; Heath, L.A.; Wilkie, S.E.; Hunt, D.M. (1997). "Visual pigments and oil droplets from six classes of photoreceptor in the retinas of birds". Vision Research. 37 (16): 2183–2194. doi:10.1016/s0042-6989(97)00026-6. PMID 9578901.
cite-note-1111. citerefsenarfiguerolapascual2002Senar JC, Figuerola J, Pascual J (February 2002). "Brighter yellow blue tits make better parents". Proceedings. Biological Sciences. 269 (1488): 257–61. doi:10.1098/rspb.2001.1882. PMC 1690890. PMID 11839194.
cite-note-johnsen-2003-1212. citerefjohnsendelheyanderssonkempenaers2003Johnsen A, Delhey K, Andersson S, Kempenaers B (June 2003). "Plumage colour in nestling blue tits: sexual dichromatism, condition dependence and genetic effects". Proceedings. Biological Sciences. 270 (1521): 1263–70. doi:10.1098/rspb.2003.2375. JSTOR 3558810. PMC 1691364. PMID 12816639.
cite-note-1313. citereflozano1994Lozano GA (1994). "Carotenoids, parasites, and sexual selection" (PDF). Oikos. 70 (2): 309–311. Bibcode:1994Oikos..70..309L. doi:10.2307/3545643. JSTOR 3545643.
cite-note-1414. Donnellan, S. C., & Mahony, M. J. (2004). Allozyme, chromosomal, and morphological variability in the Litoria lesueuri species group (Anura : Hylidae), including a description of a new species. Australian Journal of Zoology
cite-note-1515. Bell, R. C., & Zamudio, K. R. (2012). Sexual dichromatism in frogs: natural selection, sexual selection, and unexpected diversity. Proceedings of the Royal Society B: Biological Sciences.
cite-note-1616. citerefryanrand1993Ryan MJ, Rand AS (April 1993). "Species Recognition and Sexual Selection as a Unitary Problem in Animal Communication". Evolution; International Journal of Organic Evolution. 47 (2): 647–657. doi:10.2307/2410076. JSTOR 2410076. PMID 28568715.
cite-note-rubolini-2004-1717. citerefrubolinispinasaino2004Rubolini D, Spina F, Saino N (2004). "Protandry and sexual dimorphism in trans-Saharan migratory birds". Behavioral Ecology. 15 (4): 592–601. CiteSeerX 10.1.1.498.7541. doi:10.1093/beheco/arh048.
cite-note-1818. citerefshortbalaban1994Short RV, Balaban E (4 August 1994). The Differences Between the Sexes. Cambridge University Press. ISBN 9780521448789. Retrieved 3 November 2017 – via Google Books.
cite-note-1919. citerefgiacomellomarchinirasotto2006Giacomello E, Marchini D, Rasotto MB (September 2006). "A male sexually dimorphic trait provides antimicrobials to eggs in blenny fish". Biology Letters. 2 (3): 330–3. doi:10.1098/rsbl.2006.0492. PMC 1686180. PMID 17148395.
cite-note-renner-1995-2020. citerefrennerricklefs1995Renner SS, Ricklefs RE (1995). "Dioecy and its correlates in the flowering plants". American Journal of Botany. 82 (5): 596–606. doi:10.2307/2445418. JSTOR 2445418.
cite-note-2121. citerefbehnkel-ttgeesserkadereit2012Behnke H, Lüttge U, Esser K, Kadereit JW, Runge M (6 December 2012). Progress in Botany / Fortschritte der Botanik: Structural Botany Physiology Genetics Taxonomy Geobotany / Struktur Physiologie Genetik Systematik Geobotanik. Springer Science & Business Media. ISBN 978-3-642-79844-3.
cite-note-ramawat-2016-2222. citereframawatmerillonshivanna2016Ramawat KG, Merillon JM, Shivanna KR (19 April 2016). Reproductive Biology of Plants. CRC Press. ISBN 978-1-4822-0133-8.
cite-note-romero-1986-2323. citerefromeronelson1986Romero GA, Nelson CE (June 1986). "Sexual dimorphism in Catasetum orchids: forcible pollen emplacement and male flower competition". Science. 232 (4757): 1538–40. Bibcode:1986Sci...232.1538R. doi:10.1126/science.232.4757.1538. JSTOR 1698050. PMID 17773505. S2CID 31296391.
cite-note-eelgrass-2424. "Eel Grass (aka wild celery, tape grass)". University of Massachusetts. Archived from the original on 12 July 2011.
cite-note-friedman-2009-2525. citereffriedmanbarrett2009Friedman J, Barrett SC (June 2009). "Wind of change: new insights on the ecology and evolution of pollination and mating in wind-pollinated plants". Annals of Botany. 103 (9): 1515–27. doi:10.1093/aob/mcp035. PMC 2701749. PMID 19218583.
cite-note-geber-1999-2626. citerefgeber1999Geber MA (1999). Gender and sexual dimorphism in flowering plants. Berlin: Springer. ISBN 978-3-540-64597-9. p. 206
cite-note-2727. citerefbonduriansky2007Bonduriansky R (January 2007). "The evolution of condition-dependent sexual dimorphism". The American Naturalist. 169 (1): 9–19. Bibcode:2007ANat..169....9B. doi:10.1086/510214. PMID 17206580. S2CID 17439073.
cite-note-2828. citerefbarretoavise2011Barreto FS, Avise JC (August 2011). "The genetic mating system of a sea spider with male-biased sexual size dimorphism: evidence for paternity skew despite random mating success". Behavioral Ecology and Sociobiology. 65 (8): 1595–1604. Bibcode:2011BEcoS..65.1595B. doi:10.1007/s00265-011-1170-x. PMC 3134710. PMID 21874083.
cite-note-2929. citerefgrubereckeleveraarsdormann2011Gruber B, Eckel K, Everaars J, Dormann CF (30 June 2011). "On managing the red mason bee (Osmia bicornis) in apple orchards" (PDF). Apidologie. 42 (5) 564: 564–576. doi:10.1007/s13592-011-0059-z. ISSN 0044-8435. S2CID 22935710.
cite-note-3030. "hackberry emperor – Asterocampa celtis (Boisduval & Leconte)". entnemdept.ufl.edu. Retrieved 15 November 2017.
cite-note-3131. citerefrusttorchiotrostle1989Rust R, Torchio P, Trostle G (1989). "Late embryogenesis and immature development of Osmia rufa cornigera (Rossi) (Hymenoptera : Megachilidae)". Apidologie. 20 (4): 359–367. doi:10.1051/apido:19890408.
cite-note-danforth-1991-3232. citerefdanforth1991Danforth B (1991). "The morphology and behavior of dimorphic males in Perdita portalis (Hymenoptera : Andrenidae)". Behavioral Ecology and Sociobiology. 29 (4): 235–247. Bibcode:1991BEcoS..29..235D. doi:10.1007/bf00163980. S2CID 37651908.
cite-note-3333. citerefjaycox-elbert1967Jaycox Elbert R (1967). "Territorial Behavior Among Males of Anthidium Bamngense". Journal of the Kansas Entomological Society. 40 (4): 565–570.
cite-note-3434. citerefkukuk1996Kukuk PF (1 October 1996). "Male Dimorphism in Lasioglossum (Chilalictus) hemichalceum: The Role of Larval Nutrition". Journal of the Kansas Entomological Society. 69 (4): 147–157. JSTOR 25085712.
cite-note-3535. citerefpaxtongiovanettiandriettiscamoni1999Paxton RJ, Giovanetti M, Andrietti F, Scamoni E, Scanni B (1 October 1999). "Mating in a communal bee, Andrena agilissima (Hymenoptera Andrenidae)". Ethology Ecology & Evolution. 11 (4): 371–382. Bibcode:1999EtEcE..11..371P. doi:10.1080/08927014.1999.9522820. ISSN 0394-9370.
cite-note-3636. citerefwangyang2005Wang MQ, Yang D (2005). "Sexual dimorphism in insects". Chinese Bulletin of Entomology. 42: 721–725.
cite-note-sugiura-2007-3737. citerefsugiurayamauramakihara2007Sugiura S, Yamaura Y, Makihara H (November 2007). "Sexual and male horn dimorphism in Copris ochus (Coleoptera: Scarabaeidae)". Zoological Science. 24 (11): 1082–1085. doi:10.2108/zsj.24.1082. PMID 18348608. S2CID 34705415.
cite-note-3838. citerefhongo2007Hongo, Yoshihito (1 December 2007). "Evolution of male dimorphic allometry in a population of the Japanese horned beetle Trypoxylus dichotomus septentrionalis". Behavioral Ecology and Sociobiology. 62 (2): 245–253. Bibcode:2007BEcoS..62..245H. doi:10.1007/s00265-007-0459-2. ISSN 1432-0762.
cite-note-emlen-2005-3939. citerefemlenmarangeloballcunningham2005Emlen DJ, Marangelo J, Ball B, Cunningham CW (May 2005). "Diversity in the weapons of sexual selection: horn evolution in the beetle genus Onthophagus (Coleoptera: Scarabaeidae)". Evolution; International Journal of Organic Evolution. 59 (5): 1060–1084. Bibcode:2005Evolu..59.1060E. CiteSeerX 10.1.1.133.7557. doi:10.1111/j.0014-3820.2005.tb01044.x. PMID 16136805. S2CID 221736269.
cite-note-4040. Teder, T., & Tammaru, T. (2005). "Sexual size dimorphism within species increases with body size in insects". Oikos
cite-note-4141. citerefmcmahonhayward2016Mcmahon, Dino P.; Hayward, Alexander (2016). "Why grow up? A perspective on insect strategies to avoid metamorphosis". Ecological Entomology. 41 (5): 505–515. doi:10.1111/een.12313. ISSN 1365-2311.
cite-note-4242. "Flightless Female Moths". lepidoptera.butterflyhouse.com.au. Retrieved 10 July 2025.
cite-note-4343. citerefolivermonteiro2011Oliver JC, Monteiro A (July 2011). "On the origins of sexual dimorphism in butterflies". Proceedings. Biological Sciences. 278 (1714): 1981–1988. doi:10.1098/rspb.2010.2220. PMC 3107650. PMID 21123259.
cite-note-4444. citerefrobertsonmonteiro2005Robertson KA, Monteiro A (August 2005). "Female Bicyclus anynana butterflies choose males on the basis of their dorsal UV-reflective eyespot pupils". Proceedings. Biological Sciences. 272 (1572): 1541–1546. doi:10.1098/rspb.2005.3142. PMC 1559841. PMID 16048768.
cite-note-4545. citerefwiklundlindforsforsberg1996Wiklund C, Lindfors V, Forsberg J (1996). "Early Male Emergence and Reproductive Phenology of the Adult Overwintering Butterfly Gonepteryx rhamni in Sweden". Oikos. 75 (2): 227–240. Bibcode:1996Oikos..75..227W. doi:10.2307/3546246. JSTOR 3546246.
cite-note-4646. citerefkunte2008Kunte K (July 2008). "Mimetic butterflies support Wallace's model of sexual dimorphism". Proceedings. Biological Sciences. 275 (1643): 1617–1624. doi:10.1098/rspb.2008.0171. PMC 2602815. PMID 18426753.
cite-note-0-4747. "Aculeata - Ants, Bees and Stinging Wasps". bugguide.net. Retrieved 10 July 2025.
cite-note-1-4848. "The Colony and Its Organization". Mid-Atlantic Apiculture Research and Extension Consortium. Retrieved 10 July 2025.
cite-note-mclean-2018-4949. citerefmcleangarwoodbrassey2018McLean CJ, Garwood RJ, Brassey CA (2018). "Sexual dimorphism in the Arachnid orders". PeerJ. 6 e5751. doi:10.7717/peerj.5751. PMC 6225839. PMID 30416880.
cite-note-5050. citerefsmithSmith T. Discovering the daily activity pattern of Zygiella x-notata and its relationship to light (PDF) (MS thesis).
cite-note-prenter-1999-5151. citerefprenterelwoodmontgomery1999Prenter J, Elwood RW, Montgomery WI (December 1999). "Sexual Size Dimorphism and Reproductive Investment by Female Spiders: A Comparative Analysis". Evolution; International Journal of Organic Evolution. 53 (6): 1987–1994. doi:10.2307/2640458. JSTOR 2640458. PMID 28565440.
cite-note-wilder-2008-5252. citerefwilderrypstra2008Wilder SM, Rypstra AL (2008). "Sexual size dimorphism mediates the occurrence of state-dependent sexual cannibalism in a wolf spider". Animal Behaviour. 76 (2): 447–454. doi:10.1016/j.anbehav.2007.12.023. S2CID 54373571.
cite-note-5353. citereffoellmerfairbairn2004Foellmer MW, Fairbairn DJ (2004). "Males under attack: Sexual cannibalism and its consequences for male morphology and behaviour in an orb-weaving spider". Evolutionary Ecology Research. 6: 163–181.
cite-note-5454. citerefgirardeliaskasumovic2015Girard MB, Elias DO, Kasumovic MM (December 2015). "Female preference for multi-modal courtship: multiple signals are important for male mating success in peacock spiders". Proceedings. Biological Sciences. 282 (1820): 20152222. doi:10.1098/rspb.2015.2222. PMC 4685782. PMID 26631566.
cite-note-5555. citereffairbairn2013Fairbairn D (28 April 2013). Odd Couples: Extraordinary Differences between the Sexes in the Animal Kingdom. Princeton. ISBN 978-0691141961.
cite-note-5656. citerefotakohdasato2010Ota K, Kohda M, Sato T (June 2010). "Unusual allometry for sexual size dimorphism in a cichlid where males are extremely larger than females". Journal of Biosciences. 35 (2): 257–65. doi:10.1007/s12038-010-0030-6. PMID 20689182. S2CID 12396902.
cite-note-5757. citerefsato1994Sato T (1994). "Active accumulation of spawning substrate: a determinant of extreme polygyny in a shell-brooding cichlid fish". Animal Behaviour. 48 (3): 669–678. doi:10.1006/anbe.1994.1286. S2CID 53192909.
cite-note-5858. citerefsch-tztaborsky2005Schütz D, Taborsky M (2005). "Mate choice and sexual conflict in the size dimorphic water spider Argyroneta aquatica (Araneae: Argyronetidae)" (PDF). Journal of Arachnology. 33 (3): 767–775. doi:10.1636/S03-56.1. S2CID 26712792. Archived from the original (PDF) on 20 March 2012. Retrieved 14 May 2011.
cite-note-5959. citerefmccormickryenmundaywalker2010McCormick MI, Ryen CA, Munday PL, Walker SP (May 2010). Briffa M (ed.). "Differing mechanisms underlie sexual size-dimorphism in two populations of a sex-changing fish". PLOS ONE. 5 (5): e10616. Bibcode:2010PLoSO...510616M. doi:10.1371/journal.pone.0010616. PMC 2868897. PMID 20485547.
cite-note-6060. citerefwarner1988Warner RR (June 1988). "Sex change and the size-advantage model". Trends in Ecology & Evolution. 3 (6): 133–6. Bibcode:1988TEcoE...3..133W. doi:10.1016/0169-5347(88)90176-0. PMID 21227182.
cite-note-6161. citerefadamswilliams2001Adams S, Williams AJ (2001). "A preliminary test of the transitional growth spurt hypothesis using the protogynous coral trout Plectropomus maculatus". Journal of Fish Biology. 59 (1): 183–185. Bibcode:2001JFBio..59..183A. doi:10.1111/j.1095-8649.2001.tb02350.x.
cite-note-hendry-1999-6262. citerefhendryberg1999Hendry A, Berg OK (1999). "Secondary sexual characters, energy use, senescence, and the cost of reproduction in sockeye salmon". Canadian Journal of Zoology. 77 (11): 1663–1675. doi:10.1139/cjz-77-11-1663.
cite-note-amundsen-2001-6363. citerefamundsenforsgren2001Amundsen T, Forsgren E (November 2001). "Male mate choice selects for female coloration in a fish". Proceedings of the National Academy of Sciences of the United States of America. 98 (23): 13155–60. Bibcode:2001PNAS...9813155A. doi:10.1073/pnas.211439298. PMC 60840. PMID 11606720.
cite-note-svensson-2006-6464. citerefsvenssonp-labonblountsurai2006Svensson PA, Pélabon C, Blount JD, Surai PF, Amundsen T (2006). "Does female nuptial coloration reflect egg carotenoids and clutch quality in the Two-Spotted Goby (Gobiusculus flavescens, Gobiidae)?". Functional Ecology. 20 (4): 689–698. Bibcode:2006FuEco..20..689S. doi:10.1111/j.1365-2435.2006.01151.x. hdl:10536/DRO/DU:30038904.
cite-note-6565. citerefbutlerschoenerlosos2000Butler MA, Schoener TW, Losos JB (February 2000). "The relationship between sexual size dimorphism and habitat use in Greater Antillean Anolis lizards". Evolution; International Journal of Organic Evolution. 54 (1): 259–72. doi:10.1111/j.0014-3820.2000.tb00026.x. PMID 10937202. S2CID 7887284.
cite-note-6666. citerefsangerseavtokitalangerhans2014Sanger TJ, Seav SM, Tokita M, Langerhans RB, Ross LM, Losos JB, Abzhanov A (June 2014). "The oestrogen pathway underlies the evolution of exaggerated male cranial shapes in Anolis lizards". Proceedings. Biological Sciences. 281 (1784): 20140329. doi:10.1098/rspb.2014.0329. PMC 4043096. PMID 24741020.
cite-note-pinto-2005-6767. Pinto, A., Wiederhecker, H., & Colli, G. (2005). Sexual dimorphism in the Neotropical lizard, Tropidurus torquatus (Squamata, Tropiduridae). Amphibia-Reptilia.
cite-note-olsson-2012-6868. citerefolssontoblerhealeyperrin2012Olsson M, Tobler M, Healey M, Perrin C, Wilson M (August 2012). "A significant component of ageing (DNA damage) is reflected in fading breeding colors: an experimental test using innate antioxidant mimetics in painted dragon lizards". Evolution; International Journal of Organic Evolution. 66 (8): 2475–83. doi:10.1111/j.1558-5646.2012.01617.x. PMID 22834746. S2CID 205783815.
cite-note-caron-2024-6969. citerefcaronpie2024Caron FS, Pie MR (2024). "The macroevolution of sexual size dimorphism in birds". Biological Journal of the Linnean Society. 141 (5): in press. doi:10.1093/biolinnean/blad168.
cite-note-bravo-2024-7070. citerefbravobautista-sopelanaalonso2024Bravo CR, Bautista-Sopelana LM, Alonso JC (2024). "Revisiting niche divergence hypothesis in sexually dimorphic birds: Is diet overlap correlated with sexual size dimorphism?". Journal of Animal Ecology. 93 (4): 460–474. Bibcode:2024JAnEc..93..460B. doi:10.1111/1365-2656.14058. hdl:10261/360371. PMID 38462717.
cite-note-7171. Andersson 1994, p. 269
cite-note-7272. citerefbernsadams2012Berns CM, Adams DC (11 November 2012). "Becoming Different But Staying Alike: Patterns of Sexual Size and Shape Dimorphism in Bills of Hummingbirds". Evolutionary Biology. 40 (2): 246–260. doi:10.1007/s11692-012-9206-3. ISSN 0071-3260. S2CID 276492.
cite-note-7373. citerefmcgrawhillstradiparker2002McGraw KJ, Hill GE, Stradi R, Parker RS (February 2002). "The effect of dietary carotenoid access on sexual dichromatism and plumage pigment composition in the American goldfinch" (PDF). Comparative Biochemistry and Physiology. Part B, Biochemistry & Molecular Biology. 131 (2): 261–9. doi:10.1016/S1096-4959(01)00500-0. PMID 11818247. Archived from the original (PDF) on 28 August 2005.
cite-note-7474. citerefgibbsweatherheadboagwhite1990Gibbs, H. Lisle; Weatherhead, Patrick J.; Boag, Peter T.; White, Bradley N.; Tabak, Lisa M.; Hoysak, Drew J. (1990). "Realized Reproductive Success of Polygynous Red-Winged Blackbirds Revealed by DNA Markers". Science. 250 (4986): 1394–1397. Bibcode:1990Sci...250.1394L. doi:10.1126/science.250.4986.1394. PMID 17754986.
cite-note-lindsay-2009-7575. citereflindsaywebstervarianschwabl2009Lindsay WR, Webster MS, Varian CW, Schwabl H (2009). "Plumage colour acquisition and behaviour are associated with androgens in a phenotypically plastic bird". Animal Behaviour. 77 (6): 1525–1532. doi:10.1016/j.anbehav.2009.02.027. S2CID 15799876.
cite-note-7676. citerefpetrie1994Petrie M (1994). "Improved growth and survival of offspring of peacocks with more elaborate trains". Nature. 371 (6498): 598–599. Bibcode:1994Natur.371..598P. doi:10.1038/371598a0. S2CID 4316752.
cite-note-7777. citerefrubolinispinasaino2004Rubolini D, Spina F, Saino N (2004). "Protandry and sexual dimorphism in trans-saharan migratory birds". Behavioral Ecology. 15 (4): 592–601. doi:10.1093/beheco/arh048.
cite-note-7878. citerefkissnerweatherheadfrancis2003Kissner KJ, Weatherhead PJ, Francis CM (January 2003). "Sexual size dimorphism and timing of spring migration in birds". Journal of Evolutionary Biology. 16 (1): 154–62. CiteSeerX 10.1.1.584.2867. doi:10.1046/j.1420-9101.2003.00479.x. PMID 14635890. S2CID 13830052.
cite-note-m-ller-2006-7979. citerefm-llernielsen2006Møller AP, Nielsen JT (2006). "Prey vulnerability in relation to sexual coloration of prey". Behavioral Ecology and Sociobiology. 60 (2): 227–233. Bibcode:2006BEcoS..60..227M. doi:10.1007/s00265-006-0160-x. S2CID 36836956.
cite-note-adkins-regan-2007-8080. citerefadkins-regan2007Adkins-Regan E (2007). "Hormones and the development of sex differences in behavior". Journal of Ornithology. 148 (Supplement 1): S17 – S26. doi:10.1007/s10336-007-0188-3. S2CID 13868097.
cite-note-martin-2008-8181. citerefmartingr-eblerm-llerspaar2008Martin U, Grüebler HS, Müller M, Spaar R, Horch P, Naef-Daenzer B (2008). "Female biased mortality caused by anthropogenic nest loss contributes to population decline and adult sex ratio of a meadow bird". Biological Conservation. 141 (12): 3040–3049. Bibcode:2008BCons.141.3040G. doi:10.1016/j.biocon.2008.09.008.
cite-note-8282. Owens, I. P. F., Short, R.V.,. (1995). Hormonal basis of sexual dimorphism in birds: Implications for new theories of sexual selection. Trends in Ecology & Evolution., 10(REF), 44.
cite-note-coyne-2008-8383. citerefcoynekaypruett-jones2008Coyne JA, Kay EH, Pruett-Jones S (January 2008). "The genetic basis of sexual dimorphism in birds". Evolution; International Journal of Organic Evolution. 62 (1): 214–9. doi:10.1111/j.1558-5646.2007.00254.x. PMID 18005159. S2CID 11490688.
cite-note-8484. citerefvelando2002Velando A (2002). "Experimental Manipulation of Maternal Effort Produces Differential Effects in Sons and Daughters: Implications for Adaptive Sex Ratios in the Blue-footed Booby". Behavioral Ecology. 13 (4): 443–449. doi:10.1093/beheco/13.4.443.
cite-note-8585. citerefloonstraverhoevenpiersma2018Loonstra AJ, Verhoeven MA, Piersma T (2018). "Sex-specific growth in chicks of the sexually dimorphic Black-tailed Godwit" (PDF). Ibis. 160 (1): 89–100. doi:10.1111/ibi.12541. S2CID 90880117.
cite-note-main-2008-8686. citerefmain2008Main MB (March 2008). "Reconciling competing ecological explanations for sexual segregation in ungulates". Ecology. 89 (3): 693–704. Bibcode:2008Ecol...89..693M. doi:10.1890/07-0645.1. PMID 18459333.
cite-note-safi-2007-8787. citerefsafik-nigkerth2007Safi K, König B, Kerth G (2007). "Sex differences in population genetics, home range size and habitat use of the parti-colored bat (Vespertilio murinus, Linnaeus 1758) in Switzerland and their consequences for conservation" (PDF). Biological Conservation. 137 (1): 28–36. Bibcode:2007BCons.137...28S. doi:10.1016/j.biocon.2007.01.011. Archived from the original (PDF) on 25 September 2017. Retrieved 2 February 2019.
cite-note-8888. citerefcoulsonmacfarlaneparsonscutter2006Coulson G, MacFarlane AM, Parsons SE, Cutter J (2006). "Evolution of sexual segregation in mammalian herbivores: kangaroos as marsupial models". Australian Journal of Zoology. 54 (3): 217–224. doi:10.1071/ZO05062.
cite-note-8989. citerefgonz-lez-sol-scroxallwood2000González-Solís J, Croxall JP, Wood AG (2000). "Sexual dimorphism and sexual segregation in foraging strategies of northern giant petrels, Macronectes halli, during incubation". Oikos. 90 (2): 390–398. Bibcode:2000Oikos..90..390G. doi:10.1034/j.1600-0706.2000.900220.x.
cite-note-summers-smith-1988-9090. citerefsummers-smith1988Summers-Smith JD (1988). The Sparrows. Calton, Staffordshire, UK: T. & A. D. Poyser. ISBN 978-0-85661-048-6.
cite-note-maiorino-2015-9191. citerefmaiorinofarkekotsakispiras2015Maiorino, Leonardo; Farke, Andrew A.; Kotsakis, Tassos; Piras, Paolo (7 May 2015). "Males Resemble Females: Re-Evaluating Sexual Dimorphism in Protoceratops andrewsi (Neoceratopsia, Protoceratopsidae)". PLOS ONE. 10 (5): e0126464. doi:10.1371/journal.pone.0126464. ISSN 1932-6203. PMC 4423778. PMID 25951329.
cite-note-9292. citerefsaitta2015Saitta, Evan Thomas (22 April 2015). "Evidence for Sexual Dimorphism in the Plated Dinosaur Stegosaurus mjosi (Ornithischia, Stegosauria) from the Morrison Formation (Upper Jurassic) of Western USA". PLOS ONE. 10 (4): e0123503. Bibcode:2015PLoSO..1023503S. doi:10.1371/journal.pone.0123503. ISSN 1932-6203. PMC 4406738. PMID 25901727.
cite-note-9393. "Stegosaurus plates may have differed between male, female". ScienceDaily. Retrieved 12 March 2024.
cite-note-9494. "Most male mammals aren't bigger than females". www.nhm.ac.uk. Retrieved 23 December 2024.
cite-note-9595. citerefarnold2004Arnold AP (September 2004). "Sex chromosomes and brain gender". Nature Reviews. Neuroscience. 5 (9): 701–8. doi:10.1038/nrn1494. PMID 15322528. S2CID 7419814.
cite-note-9696. citerefcassini2020Cassini MH (January 2020). "A mixed model of the evolution of polygyny and sexual size dimorphism in mammals". Mammal Review. 50 (1): 112–120. Bibcode:2020MamRv..50..112C. doi:10.1111/mam.12171. ISSN 0305-1838. S2CID 208557639.
cite-note-9797. citerefcappozzocampagnamonserrat1991Cappozzo HL, Campagna C, Monserrat J (1991). "Sexual Dimorphism in Newborn Southern Sea Lions". Marine Mammal Science. 7 (4): 385–394. Bibcode:1991MMamS...7..385C. doi:10.1111/j.1748-7692.1991.tb00113.x.
cite-note-9898. citerefsalognigalimbertisanvitomiller2019Salogni E, Galimberti F, Sanvito S, Miller EH (March 2019). "Male and female pups of the highly sexually dimorphic northern elephant seal (Mirounga angustirostris) differ slightly in body size". Canadian Journal of Zoology. 97 (3): 241–250. Bibcode:2019CaJZ...97..241S. doi:10.1139/cjz-2018-0220. ISSN 0008-4301. S2CID 91796880.
cite-note-9999. citerefonoboness1996Ono KA, Boness DJ (January 1996). "Sexual dimorphism in sea lion pups: differential maternal investment, or sex-specific differences in energy allocation?". Behavioral Ecology and Sociobiology. 38 (1): 31–41. Bibcode:1996BEcoS..38...31O. doi:10.1007/s002650050214. S2CID 25307359.
cite-note-100100. citereftarnawskicassiniflores2014Tarnawski BA, Cassini GH, Flores DA (2014). "Skull allometry and sexual dimorphism in the ontogeny of the southern elephant seal (Mirounga leonina)". Canadian Journal of Zoology. 31 (1): 19–31. Bibcode:2014CaJZ...92...19T. doi:10.1139/cjz-2013-0106. hdl:11336/29893.
cite-note-101101. citereflarsen2003Larsen CS (August 2003). "Equality for the sexes in human evolution? Early hominid sexual dimorphism and implications for mating systems and social behavior". Proceedings of the National Academy of Sciences of the United States of America. 100 (16): 9103–4. Bibcode:2003PNAS..100.9103L. doi:10.1073/pnas.1633678100. PMC 170877. PMID 12886010.
cite-note-102102. citerefbuss2007Buss DM (2007). "The evolution of human mating" (PDF). Acta Psychologica Sinica. 39 (3): 502–512. Archived from the original (PDF) on 12 August 2011. Retrieved 14 May 2011.
cite-note-103103. citerefdalywilson1996Daly M, Wilson M (1996). "Evolutionary psychology and marital conflict". In Buss DM, Malamuth NM (eds.). Sex, Power, Conflict: Evolutionary and Feminist Perspectives. Oxford University Press. p. 13. ISBN 978-0-19-510357-1.
cite-note-104104. "Content - Health Encyclopedia - University of Rochester Medical Center". www.urmc.rochester.edu. Retrieved 22 April 2025.
cite-note-105105. "Testosterone: What It Is, Function & Levels". 5 April 2025. Archived from the original on 5 April 2025.
cite-note-2-106106. citerefnuzzopinto2025Nuzzo, James L.; Pinto, Matheus D. (May 2025). "Sex Differences in Upper- and Lower-Limb Muscle Strength in Children and Adolescents: A Meta-Analysis". European Journal of Sport Science. 25 (5): e12282. PMC 11971925.
cite-note-107107. citerefdalyrosengrenalwisahlborg2013Daly, Robin M.; Rosengren, Bjorn E.; Alwis, Gayani; Ahlborg, Henrik G.; Sernbo, Ingemar; Karlsson, Magnus K. (6 July 2013). "Gender specific age-related changes in bone density, muscle strength and functional performance in the elderly: a-10 year prospective population-based study". BMC Geriatrics. 13 (1): 71. doi:10.1186/1471-2318-13-71. ISSN 1471-2318. PMC 3716823. PMID 23829776.
cite-note-108108. citerefchenweepanglau2020Chen, Kexun Kenneth; Wee, Shiou-Liang; Pang, Benedict Wei Jun; Lau, Lay Khoon; Jabbar, Khalid Abdul; Seah, Wei Ting; Srinivasan, Sivasubramanian; Jagadish, Mallya Ullal; Ng, Tze Pin (25 September 2020). "Bone mineral density reference values in Singaporean adults and comparisons for osteoporosis establishment – The Yishun Study". BMC Musculoskeletal Disorders. 21 (1): 633. doi:10.1186/s12891-020-03646-y. ISSN 1471-2474. PMC 7519574. PMID 32977780.
cite-note-109109. citerefrachael-rettner2014Rachael Rettner (3 January 2014). "Why Pull-Ups Are Harder for Women". livescience.com. Retrieved 23 December 2024.
cite-note-110110. citerefsparlingo-donnellsnow1998Sparling PB, O'Donnell EM, Snow TK (December 1998). "The gender difference in distance running performance has plateaued: an analysis of world rankings from 1980 to 1996". Medicine and Science in Sports and Exercise. 30 (12): 1725–9. doi:10.1097/00005768-199812000-00011. PMID 9861606.
cite-note-111111. citerefnoehrenpohlsanchezcunningham2012Noehren, Brian; Pohl, Michael B.; Sanchez, Zack; Cunningham, Tom; Lattermann, Christian (May 2012). "Proximal and distal kinematics in female runners with patellofemoral pain". Clinical Biomechanics (Bristol, Avon). 27 (4): 366–371. doi:10.1016/j.clinbiomech.2011.10.005. ISSN 1879-1271. PMC 3984468. PMID 22071426.
cite-note-112112. citerefgantghimireminmusa2024Gant, Hannah; Ghimire, Nabin; Min, Kisuk; Musa, Ibrahim; Ashraf, Maryam; Lawan, Ahmed (22 November 2024). "Impact of the Quadriceps Angle on Health and Injury Risk in Female Athletes". International Journal of Environmental Research and Public Health. 21 (12): 1547. doi:10.3390/ijerph21121547. ISSN 1660-4601. PMC 11675324. PMID 39767389.
cite-note-113113. citerefrettner2014Rettner, Rachel (3 January 2014). "Why Pull-Ups Are Harder for Women". LiveScience.
cite-note-114114. citerefle-matg-rybessonferdynus2023Le Mat, Franck; Géry, Mathias; Besson, Thibault; Ferdynus, Cyril; Bouscaren, Nicolas; Millet, Guillaume Y. (April 2023). "Running Endurance in Women Compared to Men: Retrospective Analysis of Matched Real-World Big Data". Sports Medicine (Auckland, N.Z.). 53 (4): 917–926. doi:10.1007/s40279-023-01813-4. ISSN 1179-2035. PMID 36802328.
cite-note-115115. "National Health Statistics Reports" (PDF). National Health Statistics Reports. 10. 22 October 2008. Retrieved 21 April 2012.
cite-note-116116. "United States National Health and Nutrition Examination Survey, 1999–2002" (PDF). Retrieved 1 May 2014.
cite-note-glucksman-1981-117117. citerefglucksman1981Glucksman A (1981). Sexual Dimorphism in Human and Mammalian Biology and Pathology. Academic Press. pp. 66–75. ISBN 978-0-12-286960-0. OCLC 7831448.
cite-note-dance-2019-118118. citerefdance2019Dance A (27 March 2019). "Why the sexes don't feel pain the same way". Nature. 567 (7749): 448–450. Bibcode:2019Natur.567..448D. doi:10.1038/d41586-019-00895-3. PMID 30918396. S2CID 85527866.
cite-note-119119. citerefdurden-smithdesimone1983Durden-Smith J, deSimone D (1983). Sex and the Brain. New York: Arbor House. ISBN 978-0-87795-484-2.
cite-note-120120. citerefgershgersh1981Gersh ES, Gersh I (1981). "Biology of Women". Nature. 306 (5942). Baltimore: University Park Press (original from the University of Michigan): 511. Bibcode:1983Natur.306..511.. doi:10.1038/306511b0. ISBN 978-0-8391-1622-6. S2CID 28060318.
cite-note-121121. citerefstein1987Stein JH (1987). Internal Medicine (2nd ed.). Boston: Little, Brown. ISBN 978-0-316-81236-8.
cite-note-122122. citerefmclaughlinshryer1988McLaughlin M, Shryer T (8 August 1988). "Men vs women: the new debate over sex differences". U.S. News & World Report: 50–58.
cite-note-123123. citerefmcewen1981McEwen BS (March 1981). "Neural gonadal steroid actions". Science. 211 (4488): 1303–11. Bibcode:1981Sci...211.1303M. doi:10.1126/science.6259728. PMID 6259728.
cite-note-124124. "Acute Pain Tolerance Is More Consistent Over Time in Women Than Men, According to New Research". NCCIH. Retrieved 11 May 2022.
cite-note-125125. citerefwoznickiWoznicki K. "Pain Tolerance and Sensitivity in Men, Women, Redheads, and More". WebMD. Retrieved 11 May 2022.
cite-note-126126. citereflopesrossclosedagnall2006Lopes AM, Ross N, Close J, Dagnall A, Amorim A, Crow TJ (April 2006). "Inactivation status of PCDH11X: sexual dimorphisms in gene expression levels in brain". Human Genetics. 119 (3): 267–75. doi:10.1007/s00439-006-0134-0. PMID 16425037. S2CID 19323646.
cite-note-127127. citereflombardoashwinauyeungchakrabarti2012Lombardo MV, Ashwin E, Auyeung B, Chakrabarti B, Taylor K, Hackett G, et al. (January 2012). "Fetal testosterone influences sexually dimorphic gray matter in the human brain". The Journal of Neuroscience. 32 (2): 674–80. doi:10.1523/JNEUROSCI.4389-11.2012. PMC 3306238. PMID 22238103.
cite-note-128128. "Diverse Roles for Sex Hormone-Binding Globulin in Reproduction". biolreprod.org. Archived from the original on 23 September 2015.
cite-note-fine-2010-129129. citereffine2010Fine C (August 2010). Delusions of Gender: How Our Minds, Society, and Neurosexism Create Difference (1st ed.). W. W. Norton & Company. ISBN 978-0-393-06838-2.
cite-note-jordan-young-2010-130130. citerefjordan-young2010Jordan-Young R (September 2010). Brain Storm: The Flaws in the Science of Sex Differences. Harvard University Press. ISBN 978-0-674-05730-2.
cite-note-marner-2003-131131. citerefmarnernyengaardtangpakkenberg2003Marner L, Nyengaard JR, Tang Y, Pakkenberg B (July 2003). "Marked loss of myelinated nerve fibers in the human brain with age". The Journal of Comparative Neurology. 462 (2): 144–52. doi:10.1002/cne.10714. PMID 12794739. S2CID 35293796.
cite-note-gur-1999-132132. citerefgurturetskymatsuiyan1999Gur RC, Turetsky BI, Matsui M, Yan M, Bilker W, Hughett P, Gur RE (May 1999). "Sex differences in brain gray and white matter in healthy young adults: correlations with cognitive performance". The Journal of Neuroscience. 19 (10): 4065–72. doi:10.1523/JNEUROSCI.19-10-04065.1999. PMC 6782697. PMID 10234034.
cite-note-133133. citerefleonardtowlerwelcomehalderman2008Leonard CM, Towler S, Welcome S, Halderman LK, Otto R, Eckert MA, Chiarello C (December 2008). "Size matters: cerebral volume influences sex differences in neuroanatomy". Cerebral Cortex. 18 (12): 2920–31. doi:10.1093/cercor/bhn052. PMC 2583156. PMID 18440950.
cite-note-134134. citerefl-derssteinmetzj-ncke2002Lüders E, Steinmetz H, Jäncke L (December 2002). "Brain size and grey matter volume in the healthy human brain". NeuroReport. 13 (17): 2371–4. doi:10.1097/00001756-200212030-00040. PMID 12488829.
cite-note-haier-2005-135135. citerefhaierjungyeohead2005Haier RJ, Jung RE, Yeo RA, Head K, Alkire MT (March 2005). "The neuroanatomy of general intelligence: sex matters" (PDF). NeuroImage. 25 (1): 320–7. doi:10.1016/j.neuroimage.2004.11.019. PMID 15734366. S2CID 4127512. Archived from the original (PDF) on 24 May 2010.
cite-note-szalkai-2015-136136. citerefszalkaivargagrolmusz2015Szalkai B, Varga B, Grolmusz V (2015). "Graph Theoretical Analysis Reveals: Women's Brains Are Better Connected than Men's". PLOS ONE. 10 (7): e0130045. arXiv:1501.00727. Bibcode:2015PLoSO..1030045S. doi:10.1371/journal.pone.0130045. PMC 4488527. PMID 26132764.
cite-note-szalkai-2018-137137. citerefszalkaivargagrolmusz2018Szalkai B, Varga B, Grolmusz V (June 2018). "Brain size bias compensated graph-theoretical parameters are also better in women's structural connectomes". Brain Imaging and Behavior. 12 (3): 663–673. doi:10.1007/s11682-017-9720-0. PMID 28447246. S2CID 4028467.
cite-note-138138. citerefgershonipietrokovski2017Gershoni M, Pietrokovski S (February 2017). "The landscape of sex-differential transcriptome and its consequent selection in human adults". BMC Biology. 15 (1) 7. doi:10.1186/s12915-017-0352-z. PMC 5297171. PMID 28173793.
cite-note-139139. citerefgershonipietrokovski2014Gershoni M, Pietrokovski S (July 2014). "Reduced selection and accumulation of deleterious mutations in genes exclusively expressed in men". Nature Communications. 5 4438. Bibcode:2014NatCo...5.4438G. doi:10.1038/ncomms5438. PMID 25014762.
cite-note-140140. citerefkellystoehrnunnsmyth2018Kelly CD, Stoehr AM, Nunn C, Smyth KN, Prokop ZM (December 2018). "Sexual dimorphism in immunity across animals: a meta-analysis". Ecology Letters. 21 (12): 1885–1894. Bibcode:2018EcolL..21.1885K. doi:10.1111/ele.13164. PMID 30288910.
cite-note-141141. citerefgal-ozmaieryoshidaseddu2019Gal-Oz ST, Maier B, Yoshida H, Seddu K, Elbaz N, Czysz C, et al. (September 2019). "ImmGen report: sexual dimorphism in the immune system transcriptome". Nature Communications. 10 (1) 4295. Bibcode:2019NatCo..10.4295G. doi:10.1038/s41467-019-12348-6. PMC 6754408. PMID 31541153.
cite-note-142142. citerefgrossman1989Grossman C (1989). "Possible underlying mechanisms of sexual dimorphism in the immune response, fact and hypothesis". Journal of Steroid Biochemistry. 34 (1–6): 241–251. doi:10.1016/0022-4731(89)90088-5. PMID 2696846.
cite-note-pollitzer-2013-143143. citerefpollitzer2013Pollitzer E (August 2013). "Biology: Cell sex matters". Nature. 500 (7460): 23–4. Bibcode:2013Natur.500...23P. doi:10.1038/500023a. PMID 23903733. S2CID 4318641.
cite-note-deasy-2007-144144. citerefdeasylutebbetsfeduska2007Deasy BM, Lu A, Tebbets JC, Feduska JM, Schugar RC, Pollett JB, et al. (April 2007). "A role for cell sex in stem cell-mediated skeletal muscle regeneration: female cells have higher muscle regeneration efficiency". The Journal of Cell Biology. 177 (1): 73–86. doi:10.1083/jcb.200612094. PMC 2064113. PMID 17420291.
cite-note-mittelstrass-2011-145145. citerefmittelstrassriedyukrumsiek2011Mittelstrass K, Ried JS, Yu Z, Krumsiek J, Gieger C, Prehn C, et al. (August 2011). McCarthy MI (ed.). "Discovery of sexual dimorphisms in metabolic and genetic biomarkers". PLOS Genetics. 7 (8): e1002215. doi:10.1371/journal.pgen.1002215. PMC 3154959. PMID 21852955.
cite-note-penaloza-2009-146146. citerefpenalozaestevezorlanskisikorska2009Penaloza C, Estevez B, Orlanski S, Sikorska M, Walker R, Smith C, et al. (June 2009). "Sex of the cell dictates its response: differential gene expression and sensitivity to cell death inducing stress in male and female cells". FASEB Journal. 23 (6): 1869–79. doi:10.1096/fj.08-119388. PMC 2698656. PMID 19190082.
cite-note-vollrath-1992-147147. citerefvollrathparker1992Vollrath F, Parker GA (1992). "Sexual dimorphism and distorted sex ratios in spiders". Nature. 360 (6400): 156–159. Bibcode:1992Natur.360..156V. doi:10.1038/360156a0. S2CID 4320130.
cite-note-148148. citerefbornholdtoliveirafabi-n2008Bornholdt R, Oliveira LR, Fabián ME (November 2008). "Sexual size dimorphism in Myotis nigricans (Schinz, 1821) (Chiroptera: Vespertilionidae) from south Brazil" (PDF). Brazilian Journal of Biology. 68 (4): 897–904. doi:10.1590/S1519-69842008000400028. PMID 19197511.
cite-note-149149. citerefhayssenkunz1996Hayssen V, Kunz TH (1996). "Allometry of litter mass in bats: comparisons with maternal size, wing morphology, and phylogeny". Journal of Mammalogy. 77 (2): 476–490. doi:10.2307/1382823. JSTOR 1382823.
cite-note-150150. citerefarnqvistjoneselgar2003Arnqvist G, Jones TM, Elgar MA (July 2003). "Insect behaviour: reversal of sex roles in nuptial feeding" (PDF). Nature. 424 (6947): 387. Bibcode:2003Natur.424..387A. doi:10.1038/424387a. PMID 12879056. S2CID 4382038. Archived from the original (PDF) on 15 September 2004.
cite-note-151151. Mechanism of Fertilization: Plants to Humans, edited by Brian Dale
cite-note-152152. citerefshaw2000Shaw AJ (2000). "Population ecology, population genetics, and microevolution". In Shaw AJ, Goffinet B (eds.). Bryophyte Biology. Cambridge: Cambridge University Press. pp. 379–380. ISBN 978-0-521-66097-6.
cite-note-schuster-1984-153153. citerefschuster1984Schuster RM (1984). "Comparative Anatomy and Morphology of the Hepaticae". New Manual of Bryology. Vol. 2. Nichinan, Miyazaki, Japan: The Hattori botanical Laboratory. p. 891.
cite-note-crum-1980-154154. citerefcrumanderson1980Crum HA, Anderson LE (1980). Mosses of Eastern North America. Vol. 1. New York: Columbia University Press. p. 196. ISBN 978-0-231-04516-2.
cite-note-155155. citerefbriggs1965Briggs D (1965). "Experimental taxonomy of some British species of genus Dicranum". New Phytologist. 64 (3): 366–386. Bibcode:1965NewPh..64..366B. doi:10.1111/j.1469-8137.1965.tb07546.x. JSTOR 2430169.
cite-note-1561. citerefdies-alvarezrushtongozalopillola2010Dies Alvarez ME, Rushton AW, Gozalo R, Pillola GL, Linan E, Ahlberg P (2010). "Paradoxides brachyrhachis Linnarsson, 1883 versus Paradoxides mediterraneus Pompeckj, 1901: a problematic determination". GFF. 132 (2): 95–104. Bibcode:2010GFF...132...95D. doi:10.1080/11035897.2010.481363. S2CID 129620469.
cite-note-157157. citerefpadianhorner2014Padian K, Horner JR (1 November 2014). "Darwin's sexual selection: Understanding his ideas in context". Comptes Rendus Palevol. 13 (8): 709–715. Bibcode:2014CRPal..13..709P. doi:10.1016/j.crpv.2014.09.001. ISSN 1631-0683.
cite-note-158158. citereftogashibarteltyoshimuratainaka2012Togashi T, Bartelt JL, Yoshimura J, Tainaka K, Cox PA (August 2012). "Evolutionary trajectories explain the diversified evolution of isogamy and anisogamy in marine green algae". Proceedings of the National Academy of Sciences of the United States of America. 109 (34): 13692–7. Bibcode:2012PNAS..10913692T. doi:10.1073/pnas.1203495109. PMC 3427103. PMID 22869736.
cite-note-159159. citerefhanschenherronwiensnozaki2018Hanschen, Erik R.; Herron, Matthew D.; Wiens, John J.; Nozaki, Hisayoshi; Michod, Richard E. (September 2018). "Multicellularity Drives the Evolution of Sexual Traits". The American Naturalist. 192 (3): E93 – E105. Bibcode:2018ANat..192E..93H. doi:10.1086/698301. ISSN 0003-0147. PMC 6685534. PMID 30125231.
cite-note-160160. citerefsiljestammartinossi-allibert2024Siljestam, Mattias; Martinossi-Allibert, Ivain (2024). "Anisogamy Does Not Always Promote the Evolution of Mating Competition Traits in Males". The American Naturalist. 203 (2): 230–253. Bibcode:2024ANat..203..230S. doi:10.1086/727968. PMID 38306281.
cite-note-161161. citerefreshcard-2009Resh, Vincent H.; Cardé, Ring T. (22 July 2009). Encyclopedia of Insects. Academic Press. ISBN 978-0-08-092090-0.
cite-note-162162. citerefparker1982Parker GA (May 1982). "Why are there so many tiny sperm? Sperm competition and the maintenance of two sexes". Journal of Theoretical Biology. 96 (2): 281–94. Bibcode:1982JThBi..96..281P. doi:10.1016/0022-5193(82)90225-9. PMID 7121030. S2CID 29879237.
cite-note-163163. citerefyang2010Yang JN (May 2010). "Cooperation and the evolution of anisogamy". Journal of Theoretical Biology. 264 (1): 24–36. Bibcode:2010JThBi.264...24Y. doi:10.1016/j.jtbi.2010.01.019. PMID 20097207.
cite-note-164164. citerefbell1985Bell G (1985). "On the function of flowers". Proceedings of the Royal Society B: Biological Sciences. 224 (1235): 223–266. Bibcode:1985RSPSB.224..223B. doi:10.1098/rspb.1985.0031. JSTOR 36033. S2CID 84275261.
cite-note-165165. citerefgengde-hoffumen2014Geng S, De Hoff P, Umen JG (July 2014). "Evolution of sexes from an ancestral mating-type specification pathway". PLOS Biology. 12 (7): e1001904. doi:10.1371/journal.pbio.1001904. PMC 4086717. PMID 25003332.
cite-note-166166. citerefkaufmannwolakhusbyimmonen2021Kaufmann P, Wolak ME, Husby A, Immonen E (October 2021). "Rapid evolution of sexual size dimorphism facilitated by Y-linked genetic variance". Nature Ecology & Evolution. 5 (10): 1394–1402. Bibcode:2021NatEE...5.1394K. doi:10.1038/s41559-021-01530-z. PMID 34413504. S2CID 237242736.
cite-note-futuyma-2005-167167. Futuyma 2005, p. 330
cite-note-futuyma-2005-2-168168. Futuyma 2005, p. 331
cite-note-futuyma-2005-3-169169. Futuyma 2005, p. 332
cite-note-ridley-2004-170170. Ridley 2004, p. 328
cite-note-futuyma-2005-4-171171. Futuyma 2005, p. 335
cite-note-ridley-2004-2-172172. Ridley 2004, p. 330
cite-note-ridley-2004-3-173173. Ridley 2004, p. 332

Sources

• citerefandersson1994Andersson MB (1994). Sexual Selection. Princeton University Press. ISBN 978-0-691-00057-2.
• citereffutuyma2005Futuyma D (2005). Evolution (1st ed.). Sunderland, Massachusetts: Sinauer Associates. ISBN 978-0-87893-187-3.
• citerefridley2004Ridley M (2004). Evolution (3rd ed.). Malden, Massachusetts: Blackwell Publishing. ISBN 978-1-4051-0345-9.

Further reading

• citerefbonduriansky2007Bonduriansky R (January 2007). "The evolution of condition-dependent sexual dimorphism". The American Naturalist. 169 (1): 9–19. Bibcode:2007ANat..169....9B. doi:10.1086/510214. PMID 17206580. S2CID 17439073.
• citereffiguerola1999Figuerola J (1999). "A comparative study on the evolution of reversed size dimorphism in monogamous waders". Biological Journal of the Linnean Society. 67 (1): 1–18. doi:10.1111/j.1095-8312.1999.tb01926.x. hdl:10261/44557. S2CID 85330510.
• citerefsz-kelylislevandfiguerolafairbairn2007Székely T, Lislevand T, Figuerola J, Fairbairn D, Blanckenhorn W (2007). Sex, Size, and Gender Roles: Evolutionary Studies of Sexual Size Dimorphism. pp. 16–26.

External links

Look up

sexual dimorphism

in Wiktionary, the free dictionary.

Wikimedia Commons has media related to

Sexual dimorphism

.

• Sex+dimorphism at the U.S. National Library of Medicine Medical Subject Headings (MeSH)